PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB_related
Protein Properties Length: 1592aa    MW: 172546 Da    PI: 5.958
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001552.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21.1e-09828868345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT +E   +++a   +G++ +++I++++g +R+++qck ++ 
      Aco001552.1 828 DWTDDEKSVFIRALSTYGKD-FARISQCVG-TRSREQCKIFFS 868
                      6*****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-13632695IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-5641693IPR009057Homeodomain-like
PROSITE profilePS5129313.869645696IPR017884SANT domain
SMARTSM007173.7E-8646694IPR001005SANT/Myb domain
PROSITE profilePS5129314.173824875IPR017884SANT domain
SMARTSM007171.3E-8825873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-5828869IPR009057Homeodomain-like
SuperFamilySSF466895.23E-10828876IPR009057Homeodomain-like
PfamPF002492.8E-8828867IPR001005SANT/Myb domain
CDDcd001673.07E-7829867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1592 aa     Download sequence    Send to blast
MPPEPLPWDR KDFVSKERKH DRGAGSDALG GGGASSTPWW REPYHGPRPF FRASPRRPPS  60
GHYRQGGGYH QFYPEDPASH GCTPSVAVPI SSPTSHQPPL KDHQNDKNNA GGVDDGSGTG  120
QRSDRDHPLG SISWKPLKWP RSSSLSSAKS GRSEPEEGKL EVSVPSGQET PIRSPVTSPQ  180
PSDEGAARKK PRLGWGQGLA KYERQKVQGS IDLTSPSAAG GAGCSSPATP SSATCSSSPA  240
LTDDKICTKA VNSENETNNQ SASGLGFQHC SGESLIKLDY LDNPIGSLTS ILADLLGPED  300
ACSGDSTSTR LVAVNKLFQL KGDVSKELEK TESEIDLLES VLKTVDSTAE NDCHLPSNLP  360
ASNALESCLG ASDGVSENSK DVEMGKLEAV PSALMHFKES DIKDVQTEPA ECPLRLKDDT  420
LEATSICDDG KKHSTEDVSS RDYAIIACSH GRTSCNLISL ITASNQDSER RALDVFNKTL  480
PTNQSKTDIW ESSDLSRHRK NDLKVKEKIA VRKRILKFKE QALSLKFRAF HHLWKEDLRL  540
LSVRKSRTKS NKRVDISNYS SHSGSQKQRS SIRSRFALPG NVTLVPTTEI VEFTSKLLSD  600
SQTKLCRSYL KMPALILDNE EKKHAKFITY NGIIEDPISL EKEKAKVNPW SQEEKDIFME  660
KLAAFGKDFG RISSFLTHKT TADCVEFYYK NHKSESFSEV KKLLDLRKQQ QCLPTSTYLL  720
TSDKRWNPGA NAASLDMLEA ASFVAEHTQS VKEMSGNERE SIAAGVLAGI CGAISSEAMS  780
SCITTTISPS EKIKYVANDR QLATEVTQNL DEEDTCSDEN CGEVASVDWT DDEKSVFIRA  840
LSTYGKDFAR ISQCVGTRSR EQCKIFFSKA RKCLGLDAVL QGNDNVGILP TSDTNGGRSD  900
TDDICAAEID SAICSTQSCS KVDGDVSQSV ANGNSEGLAH AGADRSSENE VAGGINLENE  960
SKIGRNLEEN ESKVERNFEE NESEVGINLE ENESKVGINL EENESKVGIN LEENESKVGI  1020
NLEENERKVE INLEENGSKV DKQQCVVHDV KVENEEVKEE SYTTPKNSVA ALSCKEPVEP  1080
EVAENIDTEK KKVEGGVIPP SEAFVTAGLE GKLNSQTACV IQQKDATGVL SSNGLRKEVN  1140
LHQPLAPEVG SNRRRRASID LGTSSSYTLC FGSDPSANEN NLYLENSFGV CSRLTTISTN  1200
NLHQLPLELR TCLPKKTQGI TLKQENCQSV QSSAVFSNPS SICFDGTHPS QIILNSDEHT  1260
NKRHQCSAAR DLYQQYVLKN PSLNQVDQPL QVLKGYPLQI FNQNEVKRES VPSVSGNPFL  1320
LESHSRRNGA SQSNPFFVWN AQKDKCNGSS VSHSSSATLT PSKIDDKSEV QQSQLTGDIK  1380
LFGKILSQPS SQKSTSSPPE NKSRPLSPAT NGSSALAKPS NIVNDGAPHS SVPGSSSKTG  1440
LEELPVRSYG FWDGNRIQTG FSSLSESALM LAKYQGSLAG VSLYKDGAPG GNAIIKDYHP  1500
SFLQHLSSDG KRVENFTELQ KRGAGIEPMS GFKQSGRAVV RLGAANIVGP AGILADGAVS  1560
DPVAALKMLY PSSGQVIGAE MKSWTGDIGG R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C7e-17607697493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D7e-17607697493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937839.10.0PREDICTED: uncharacterized protein LOC105057083 isoform X3
TrEMBLM0TXE90.0M0TXE9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P04400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-100MYB family protein